PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G267300.1
Common NamePHAVU_003G267300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 169aa    MW: 19332.5 Da    PI: 6.241
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G267300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81.1e-12101146147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r+ W+ eE++l++ + +++Gg  Wk+I++ +  ++t+ q+ s+ qky
  Phvul.003G267300.1 101 RKTWSIEEHKLFLLGLRMYGGS-WKKISENVVRTKTPSQLASHAQKY 146
                         789*****************88.***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.25696151IPR017930Myb domain
SuperFamilySSF466892.24E-1497151IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-13100150IPR006447Myb domain, plants
SMARTSM007177.3E-9100149IPR001005SANT/Myb domain
PfamPF002491.2E-10101146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-6101145IPR009057Homeodomain-like
CDDcd001671.54E-6103147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MSRVEGNEWE SALNDELFNI NFEDIFGVSI DQMLGDVNYP EETSNLQGQP LSQQSFSDHP  60
LTQLNESVTH VESGPTQLPD NPPNSEHQNG GCGPSRQRQP RKTWSIEEHK LFLLGLRMYG  120
GSWKKISENV VRTKTPSQLA SHAQKYFIRQ KMEPSQRKRK SIHDITLEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155160QRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156208.11e-124hypothetical protein PHAVU_003G267300g, partial
TrEMBLV7CDE71e-124V7CDE7_PHAVU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-23MYB family protein